Anti-CUX2 Mouse Monoclonal Antibody [clone: 2H8]
Catalog # ABNOH00023316-M03
Supplier: Abnova
Specifications
- Antibody type:Primary
- Antigen name:Cut-like homeobox 2
- Antigen symbol:CUX2
- Clonality:Monoclonal
- Clone:2H8
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG1 kappa
- Reactivity:Human
- Western blot:Yes
- Environmentally Preferable:
- Cross adsorption:No
- Format:Liquid
- Form:Liquid
- Gene ID:23316
- Antigen synonyms:CUTL2|CDP2
- Amino acid number:121 to 220
- Storage buffer:In 1x PBS, pH 7,4
- Sequence:FDPSGQPRRDLHTSWKRNPELLSPKEQREGTSPAGPTLTEGSRLPGIPGKALLTETLLQRNEAEKQKGLQEVQITLAARLGEAEEKIKVLHSALKATQAE
- Storage temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:CUX2 (NP_056082.1, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Size:100 µg
- Pk:100 µg
Specifications
About this item
Mouse monoclonal antibody raised against a partial recombinant CUX2.
Recommended Dilutions: Western Blot: 1-5 ?g/ml
Type: Primary
Antigen: CUX2
Clonality: Monoclonal
Clone: 2H8
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG1 kappa
Reactivity: Human