Order Entry
United States
ContactUsLinkComponent
Anti-Splicing factor, arginine/serine-rich 11 Rabbit Polyclonal Antibody
Anti-Splicing factor, arginine/serine-rich 11 Rabbit Polyclonal Antibody
Catalog # 102189-542
Supplier:  Novus Biologicals
Anti-Splicing factor, arginine/serine-rich 11 Rabbit Polyclonal Antibody
Catalog # 102189-542
Supplier:  Novus Biologicals
Supplier Number:  NBP1-57324
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

  • • State issued document with your organization's Federal Tax ID Number
  • • State issued document with your organization's Resale Tax ID Number
  • • City or County issued Business License
  • • State Department of Health Services License
  • • Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.

Specifications

  • Antibody Type:
    Primary
  • Antigen Name:
    Splicing factor, arginine/serine-rich 11
  • Antigen Symbol:
    SF1
  • Clonality:
    Polyclonal
  • Conjugation:
    Unconjugated
  • Host:
    Rabbit
  • Isotype:
    IgG
  • Reactivity:
    Human
  • Western Blot:
    Yes
  • Size:
    100 μl
  • Environmentally Preferable:
  • Gene ID:
    9295
  • Antigen Synonyms:
    SFRS11|dJ677H15.2|Splicing factor|arginine/serine-rich 11FLJ18226|SR splicing factor 11|serine/arginine-rich splicing factor 11|DKFZp686M13204|Arginine-rich 54 kDa nuclear protein|splicing factor p54|p54NET2
  • Storage Buffer:
    PBS & 2% Sucrose.
  • Storage Temperature:
    Store at -20C. Avoid freeze-thaw cycles.
  • Immunogen:
    Synthetic peptides corresponding to SFRS11(splicing factor, arginine/serine-rich 11) The peptide sequence was selected from the C terminal of SFRS11. Peptide sequence KKKSKDKEKDRERKSESDKDVKQVTRDYDEEEQGYDSEKEKKEEKKPIET.
  • Purification:
    Immunogen affinity purified
  • Cat. No.:
    102189-542
  • Supplier no.:
    NBP1-57324

Specifications

About this item

The Splicing factor, arginine / serine-rich 11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Splicing factor, arginine / serine-rich 11. This antibody reacts with human. The Splicing factor, arginine / serine-rich 11 Antibody has been validated for the following applications: Western Blot.

Type: Primary
Antigen: Splicing factor, arginine/serine-rich 11
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human