Order Entry
United States
ContactUsLinkComponent
Anti-SLC22A15 Rabbit Polyclonal Antibody
Anti-SLC22A15 Rabbit Polyclonal Antibody
Catalog # 102195-580
Supplier:  Novus Biologicals
Anti-SLC22A15 Rabbit Polyclonal Antibody
Catalog # 102195-580
Supplier:  Novus Biologicals
Supplier Number:  NBP1-62420
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

  • • State issued document with your organization's Federal Tax ID Number
  • • State issued document with your organization's Resale Tax ID Number
  • • City or County issued Business License
  • • State Department of Health Services License
  • • Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.

Specifications

  • Antibody Type:
    Primary
  • Antigen Name:
    Solute Carrier Family 22 Member A15
  • Antigen Symbol:
    SLC22A15
  • Clonality:
    Polyclonal
  • Conjugation:
    Unconjugated
  • Host:
    Rabbit
  • Isotype:
    IgG
  • Reactivity:
    Human
  • Western Blot:
    Yes
  • Size:
    100 μl
  • Environmentally Preferable:
  • Gene ID:
    55356
  • Antigen Synonyms:
    solute carrier family 22 (organic cation transporter)|trans-like protein|member 15|solute carrier family 22|Fly-like putative transporter 1|solute carrier family 22 member 15|DKFZp761G0313|fly-like putative organic ion transporter 1|Flipt 1|FLIPT1PRO34686
  • Storage Buffer:
    PBS and 2% Sucrose
  • Storage Temperature:
    Store at -20C. Avoid freeze-thaw cycles.
  • Immunogen:
    Synthetic peptides corresponding to SLC22A15(solute carrier family 22, member 15) The peptide sequence was selected from the middle region of SLC22A15. Peptide sequence NQKWFGRKRTLSAFLCLGGLACLIVMFLPEKKDTGVFAVVNSHSLSLLGK.
  • Purification:
    Immunogen affinity purified
  • Cat. No.:
    102195-580
  • Supplier no.:
    NBP1-62420

Specifications

About this item

The SLC22A15 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC22A15. This antibody reacts with human. The SLC22A15 Antibody has been validated for the following applications: Western Blot.

Type: Primary
Antigen: SLC22A15
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human