To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
- Antibody Type:Primary
- Antigen Name:Protein Arginine Methytransferase 8
- Antigen Symbol:PRMT8
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100μl
- Environmentally Preferable:
- Gene ID:56341
- Antigen Synonyms:HMT1 hnRNP methyltransferase-like 3|HMT1 hnRNP methyltransferase-like 3 (S. cerevisiae)|protein arginine N-methyltransferase 8|EC 2.1.1.77|EC 2.1.1.-|protein arginine methyltransferase 8|EC 2.1.1|protein arginine N-methyltransferase 4|HMT1 hnRNP methyltransferase-like 4|HRMT1L4|Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 4|HRMT1L3|HMT1 hnRNP methyltransferase-like 4 (S. cerevisiae)
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to PRMT8(protein arginine methyltransferase 8) The peptide sequence was selected from the C terminal of PRMT8 (NP_872294). Peptide sequence YLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSND.
- Purification:Protein A purified
- Cat. No.:102185-746
- Supplier no.:NBP1-55401
The PRMT8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PRMT8. This antibody reacts with human. The PRMT8 Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: PRMT8
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human