To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
- Antibody Type:Primary
- Antigen Name:NEDD4-binding protein 2-like 2
- Antigen Symbol:N4BP2L2
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Environmentally Preferable:
- Gene ID:10443
- Antigen Synonyms:CG005FLJ41089|FLJ36195|protein from BCRA2 region|PFAAP5FLJ43077|Phosphonoformate immuno-associated protein 5,92M18.3,92M18.3 (novel protein)|NEDD4-binding protein 2-like 2|CG016|NEDD4 binding protein 2-like 2
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to RP11-298P3.3 (NEDD4 binding protein 2-like 2) The peptide sequence was selected from the N terminal of RP11-298P3.3)(50ug). Peptide sequence EYQMSISIVMNSVEPSHKSTQRPPPPQGRQRERVLKKTGHRLSKTKQKRN.
- Purification:Immunogen affinity purified
- Cat. No.:102190-404
- Supplier no.:NBP1-57762
Rabbit Polyclonal N4BP2L2 Antibody. Tested Applications: Western Blot. Tested Reactivity: Human.
Type: Primary
Antigen: N4BP2L2
Clonality: Polyclonal
Clone:
Conjugation:
Epitope:
Host: Rabbit
Isotype:
Reactivity: Human