To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Symbol:CCL16/HCC-4/LEC
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Environmentally Preferable:
- Gene ID:6360
- Antigen Synonyms:NCC4IL-10-inducible chemokine|liver CC chemokine-1|LMCSmall-inducible cytokine A16|SCYL4|Chemokine LEC|NCC-4ILINCK|CKb12|small inducible cytokine subfamily A (Cys-Cys)|SCYA16MGC117051|chemokine (C-C motif) ligand 16|HCC-4Liver-expressed chemokine|MTN-1|LEC|LCC-1Lymphocyte and monocyte chemoattractant|C-C motif chemokine 16|member 16|Chemokine CC-4|new CC chemokine 4|monotactin-1
- Storage Buffer:PBS & 2% Sucrose.
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to the N terminal of CCL16. Immunizing peptide sequence SLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKAL.
- Purification:Immunogen affinity purified
- Cat. No.:102205-114
- Supplier no.:NBP1-74186
Specifications
About this item
The CCL16 / HCC-4 / LEC Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCL16 / HCC-4 / LEC. This antibody reacts with human. The CCL16 / HCC-4 / LEC Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: CCL16/HCC-4/LEC
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human