To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Symbol:FCRN/FCGRT
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Environmentally Preferable:
- Gene ID:2217
- Antigen Synonyms:major histocompatibility complex class I-like Fc receptor|IgG receptor FcRn large subunit p51|FCRNimmunoglobulin receptor|alpha|receptor|FcRn|transporter|Neonatal Fc receptor|intestinal|alpha-chain|heavy chain|FcRn alpha chain|neonatal Fc-receptor for Ig|Fc fragment of IgG|IgG Fc fragment receptor transporter alpha chain
- Storage Buffer:1x PBS with 2% sucrose.
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to FCGRT(Fc fragment of IgG, receptor, transporter, alpha) The peptide sequence was selected from the N terminal of FCGRT (NP_004098). Peptide sequence GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLE.
- Purification:Immunogen affinity purified
- Cat. No.:102191-836
- Supplier no.:NBP1-59061
Specifications
About this item
The FCRN / FCGRT Antibody from Novus Biologicals is a rabbit polyclonal antibody to FCRN / FCGRT. This antibody reacts with human. The FCRN / FCGRT Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: FCRN/FCGRT
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human