To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Name:Dynein intermediate chain 2
- Antigen Symbol:Dynein intermediate chain 2
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Environmentally Preferable:
- Gene ID:64446
- Antigen Synonyms:intermediate polypeptide 2|Axonemal dynein intermediate chain 2|intermediate chain 2|dynein|dynein intermediate chain 2|axonemal|CILD9
- Storage Buffer:PBS & 2% Sucrose.
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptide directed towards the N terminal of human DNAI2. Peptide sequence TRGVNHVEGGWPKDVNPLELEQTIRFRKKVEKDENYVNAIMQLGSIMEHC.
- Purification:Immunogen affinity purified
- Cat. No.:102216-664
- Supplier no.:NBP1-80509
Specifications
About this item
The Dynein intermediate chain 2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Dynein intermediate chain 2. This antibody reacts with human. The Dynein intermediate chain 2 Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: Dynein intermediate chain 2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human