To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Name:Annexin A2
- Antigen Symbol:ANX2
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Mouse
- Western Blot:Yes
- Size:100μl
- Environmentally Preferable:
- Gene ID:302
- Antigen Synonyms:chromobindin 8|annexin-2|p36|LIP2PAP-IV|Lipocortin II|Protein I|Placental anticoagulant protein IV|ANX2L4LPC2|LPC2DP36|Calpactin I heavy chain|CAL1H|Calpactin-1 heavy chain|annexin A2|Annexin II|calpactin I heavy polypeptide|ANX2|Chromobindin-8
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to ANXA2 (annexin A2) The peptide sequence was selected from the C terminal of ANXA2 (NP_004030). Peptide sequence: RIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD.
- Purification:Protein A purified
- Cat. No.:102191-956
- Supplier no.:NBP1-59124
Specifications
About this item
The Annexin A2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Annexin A2. This antibody reacts with human, mouse. The Annexin A2 Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: ANX2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse