Order Entry
United States
ContactUsLinkComponent
Anti-CARF Rabbit Polyclonal Antibody
Anti-CARF Rabbit Polyclonal Antibody
Catalog # 102017-666
Supplier:  Avantor
Anti-CARF Rabbit Polyclonal Antibody
Catalog # 102017-666
Supplier:  Avantor
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

  • • State issued document with your organization's Federal Tax ID Number
  • • State issued document with your organization's Resale Tax ID Number
  • • City or County issued Business License
  • • State Department of Health Services License
  • • Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.

Specifications

  • Antibody Type:
    Primary
  • Antigen Symbol:
    CARF
  • Clonality:
    Polyclonal
  • Conjugation:
    Unconjugated
  • Host:
    Rabbit
  • Isotype:
  • Reactivity:
  • Western Blot:
    Yes
  • Size:
    100 µg
  • Environmentally Preferable:
  • Format:
    Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CARF antibody in PBS
  • Storage Temperature:
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Concentration:
    1 mg/ml
  • Immunogen:
    CARF antibody was raised using the C terminal Of Carf corresponding to a region with amino acids AIEALKATLDVFFVPLKELADLPQNKSSQESIVCELRCKSVYLGTGCGKS
  • Cat. No.:
    102017-666
  • Supplier no.:
    70R1349

Specifications

About this item

CARF was first cloned as a novel binding partner of ARF from a yeast-interactive screen. CARF and ARF colocalize in the perinucleolar region and have a collaborative function. In the nucleoplasm, CARF interacts with p53 and enhances its function. The p53 downregulates CARF in a negative feedback regulatory loop and may also involve p53 antagonist HDM2.

WB: 0.3125 ug/ml; IHC: 4-8 ug/ml

Type: Primary
Antigen: CARF
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype:
Reactivity: