Order Entry
United States
ContactUsLinkComponent
Anti-PNPO Rabbit Polyclonal Antibody
Anti-PNPO Rabbit Polyclonal Antibody
Catalog # 102020-120
Supplier:  Avantor
Anti-PNPO Rabbit Polyclonal Antibody
Catalog # 102020-120
Supplier:  Avantor
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

  • • State issued document with your organization's Federal Tax ID Number
  • • State issued document with your organization's Resale Tax ID Number
  • • City or County issued Business License
  • • State Department of Health Services License
  • • Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.

Specifications

  • Antibody Type:
    Primary
  • Antigen Symbol:
    PNPO
  • Clonality:
    Polyclonal
  • Conjugation:
    Unconjugated
  • Host:
    Rabbit
  • Isotype:
  • Reactivity:
  • Western Blot:
    Yes
  • Size:
    50 µg
  • Environmentally Preferable:
  • Format:
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PNPO antibody in PBS
  • Storage Temperature:
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Concentration:
    1 mg/ml
  • Immunogen:
    PNPO antibody was raised using the N terminal of PNPO corresponding to a region with amino acids PMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAVQCPDIGEANAMCLAT
  • Cat. No.:
    102020-120
  • Supplier no.:
    70R2576

Specifications

About this item

PNPO catalyzes the terminal, rate-limiting step in the synthesis of pyridoxal 5'-phosphate, also known as vitamin B6. Vitamin B6 is a required co-factor for enzymes involved in both homocysteine metabolism and synthesis of neurotransmitters such as catecholamine.

WB: 1 ug/ml

Type: Primary
Antigen: PNPO
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype:
Reactivity: