To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Symbol:ND6
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:
- Reactivity:
- Western Blot:Yes
- Size:50 µg
- Environmentally Preferable:
- Format:Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ND6 antibody in PBS
- Storage Temperature:Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Concentration:1 mg/ml
- Immunogen:ND6 antibody was raised using a synthetic peptide corresponding to a region with amino acids DGVVVVVNFNSVGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWT
- Cat. No.:102027-574
- Supplier no.:70R6303
Specifications
About this item
ND6 is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone
WB: 1 ug/ml
Type: Primary
Antigen: ND6
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype:
Reactivity: