Order Entry
United States
ContactUsLinkComponent
Anti-Archain 1 Rabbit Polyclonal Antibody
Anti-Archain 1 Rabbit Polyclonal Antibody
  102020-648
 :  Avantor
Anti-Archain 1 Rabbit Polyclonal Antibody
  102020-648
 :  Avantor
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

  • • State issued document with your organization's Federal Tax ID Number
  • • State issued document with your organization's Resale Tax ID Number
  • • City or County issued Business License
  • • State Department of Health Services License
  • • Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.

 

  • Antibody Type:
    Primary
  • Antigen Symbol:
    Archain 1
  • Clonality:
    Polyclonal
  • Conjugation:
    Unconjugated
  • Host:
    Rabbit
  • Isotype:
  • Reactivity:
  • Western Blot:
    Yes
  • Size:
    50 µg
  • Environmentally Preferable:
  • Format:
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ARCN1 antibody in PBS
  • Storage Temperature:
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Concentration:
    1 mg/ml
  • Immunogen:
    Archain 1 antibody was raised using the middle region of ARCN1 corresponding to a region with amino acids GGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFT
  • Cat. No.:
    102020-648
  • Supplier no.:
    70R2840

 

 

The gene that encodes ARCN1 maps in a region, which includes the mixed lineage leukemia and Friend leukemia virus integration 1 genes, where multiple disease-associated chromosome translocations occur. ARCN1 is an intracellular protein. Archain sequences are well conserved among eukaryotes and this protein may play a fundamental role in eukaryotic cell biology. It has similarities to heat shock proteins and clathrin-associated proteins, and may be involved in vesicle structure or trafficking.

WB: 1 ug/ml

Type: Primary
Antigen: Archain 1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype:
Reactivity: