Anti-SSX4 Mouse Monoclonal Antibody [clone: 3E10]
Catalog # ABNOH00006759-M02J
Supplier: Abnova
Specifications
- Antibody type:Primary
- Antigen name:Synovial sarcoma, X breakpoint 4
- Antigen symbol:SSX4
- Clonality:Monoclonal
- Clone:3E10
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG2a kappa
- Reactivity:Human
- Western blot:Yes
- Environmentally Preferable:
- Cross adsorption:No
- Format:Liquid
- Gene ID:6759
- Antigen synonyms:CT5.4
- Amino acid number:91 to 188
- Storage buffer:1x PBS, pH 7,4
- Sequence:RNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE
- Storage temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:SSX4 (NP_005627, 91 a.a. ~ 188 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Size:50 µg
- Pk:50 µg
Specifications
About this item
Mouse monoclonal antibody raised against a partial recombinant SSX4.
Recommended Dilutions: Western Blot: 1-5 ?g/ml
Type: Primary
Antigen: SSX4
Clonality: Monoclonal
Clone: 3E10
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a kappa
Reactivity: Human