Order Entry
Netherlands
ContactUsLinkComponent
Anti-LIFR Rabbit Polyclonal Antibody
Anti-LIFR Rabbit Polyclonal Antibody
  BSBTPB9661
undefined
Anti-LIFR Rabbit Polyclonal Antibody
  BSBTPB9661

 

  • Antigen name:
    leukemia inhibitory factor receptor alpha
  • Antigen symbol:
    LIFR
  • Clonality:
    Polyclonal
  • Host:
    Rabbit
  • Isotype:
    IgG
  • Reactivity:
    Human
  • Western blot:
    Yes
  • Environmentally Preferable:
  • Form:
    Lyophilized
  • Gene ID:
    3977
  • Antigen synonyms:
    SWS|SJS2|CD118|STWS|LIF-R
  • UniProtKB:
    P42702
  • Storage temperature:
    At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
  • Immunogen:
    A synthetic peptide corresponding to a sequence at the C-terminus of human LIFR(863-899aa EWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLE), different from the related mouse and rat sequences by one amino acid.
  • Purification:
    Immunogen affinity purified.
  • Size:
    100 μg / vial
  • Pk:
    100 µG

 

 

Rabbit IgG polyclonal antibody for Leukemia inhibitory factor receptor(LIFR) detection. Tested with WB in Human.

LIFR also known as CD118 (Cluster of Differentiation 118), is a subunit of a receptor for leukemia inhibitory factor. This gene encodes a protein that belongs to the type I cytokine receptor family. This protein combines with a high-affinity converter subunit, gp130, to form a receptor complex that mediates the action of the leukemia inhibitory factor, a polyfunctional cytokine that is involved in cellular differentiation, proliferation and survival in the adult and the embryo. Mutations in this gene cause Schwartz-Jampel syndrome type 2, a disease belonging to the group of the bent-bone dysplasias. A translocation that involves the promoter of this gene, t(5;8)(p13;q12) with the pleiomorphic adenoma gene 1, is associated with salivary gland pleiomorphic adenoma, a common type of benign epithelial tumor of the salivary gland. Multiple splice variants encoding the same protein have been found for this gene.

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.