Anti-NFAT5 Mouse Monoclonal Antibody [clone: 1H16]
ABNOH00010725-M02
: Abnova
- Antibody type:Primary
- Antigen name:Nuclear factor of activated T cells 5
- Antigen symbol:NFAT5
- Clonality:Monoclonal
- Clone:1H16
- Conjugation:Unconjugated
- Host:Mouse
- Isotype:IgG2a kappa
- Reactivity:
- Western blot:Yes
- Environmentally Preferable:
- Cross adsorption:No
- Format:Liquid
- Gene ID:10725
- Antigen synonyms:NF-AT5|NFATL1|T cell transcription factor NFAT5|Nuclear factor of activated T cells 5|Nuclear Factor Activated T-Cells|Tonicity-responsive enhanc
- Amino acid number:1422 to 1531
- Storage buffer:1x PBS, pH 7,4
- Sequence:FHNTAGGTMNQLQNSPGSSQQTSGMFLFGIQNNCSQLLTSGPATLPDQLMAISQPGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGNNLTGSF
- Storage temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:NFAT5 (NP_006590.1, 1422 a.a. ~ 1531 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Size:100 μg
- Pk:100 µg
Mouse monoclonal antibody raised against a partial recombinant NFAT5.
Recommended Dilutions: Western Blot: 1-5 ?g/ml
Type: Primary
Antigen: NFAT5
Clonality: Monoclonal
Clone: 1H16
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a kappa
Reactivity: