Anti-KIF21B Mouse Monoclonal Antibody [clone: 4C12]
ABNOH00023046-M03
: Abnova
- Antibody type:Primary
- Antigen name:Kinesin Family member 21B
- Antigen symbol:KIF21B
- Clonality:Monoclonal
- Clone:4C12
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG2a kappa
- Reactivity:Human
- Western blot:Yes
- Environmentally Preferable:
- Cross adsorption:No
- Format:Liquid
- Gene ID:23046
- Amino acid number:1183 to 1282
- Storage buffer:1x PBS, pH 7,4
- Sequence:VSRTVSLPTRGSTFPRQSRATETSPLTRRKSYDRGQPIRSTDVGFTPPSSPPTRPRNDRNVFSRLTSNQSQGSALDKSDDSDSSLSEVLRGIISPVGGAK
- Storage temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:KIF21B (XP_371332, 1183 a.a. ~ 1282 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Size:100 µg
- Pk:100 µg
Mouse monoclonal antibody raised against a partial recombinant KIF21B.
Recommended Dilutions: Western Blot: 1-5 ?g/ml
Type: Primary
Antigen: KIF21B
Clonality: Monoclonal
Clone: 4C12
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a kappa
Reactivity: Human