Anti-RPGRIP1 Mouse Monoclonal Antibody [clone: 5H2]
ABNOH00057096-M01
: Abnova
- Antibody type:Primary
- Antigen name:Retinitis Pigmentosa Gtpase Regulator Interacting Protein 1
- Antigen symbol:RPGRIP1
- Clonality:Monoclonal
- Clone:5H2
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG2a kappa
- Reactivity:Human
- Western blot:Yes
- Environmentally Preferable:
- Cross adsorption:No
- Format:Liquid
- Gene ID:57096
- Antigen synonyms:RPGRIP1d|RPGRIP|CORD13|LCA6|RGRIP|RGI1
- Amino acid number:1187 to 1286
- Storage buffer:1x PBS, pH 7,4
- Sequence:QGRRRFLFDMLNGQDPDQGHLKFTVVSDPLDEEKKECEEVGYAYLQLWQILESGRDILEQELDIVSPEDLATPIGRLKVSLQAAAVLHAIYKEMTEDLFS
- Storage temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:RPGRIP1 (NP_065099.2, 1187 a.a. ~ 1286 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Size:100 µg
- Pk:100 µg
Mouse monoclonal antibody raised against a partial recombinant RPGRIP1.
Recommended Dilutions: Western Blot: 1-5 ?g/ml
Type: Primary
Antigen: RPGRIP1
Clonality: Monoclonal
Clone: 5H2
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a kappa
Reactivity: Human