Anti-ADAMTS3 Mouse Monoclonal Antibody [clone: 1D6]
Catalog # ABNOH00009508-M08A
Supplier: Abnova
Specifications
- Antibody type:Primary
- Antigen name:ADAM Metallopeptidase With Thrombospondin Type 1 Motif, 3
- Antigen symbol:ADAMTS3
- Clonality:Monoclonal
- Clone:1D6
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG2a kappa
- Reactivity:Human
- Western blot:Yes
- Environmentally Preferable:
- Cross adsorption:No
- Format:Liquid
- Form:Ascites fluid
- Gene ID:9508
- Antigen synonyms:ADAMTS-4|KIAA0366
- Amino acid number:1048 to 1128
- Sequence:ESCSKRSSTLPPPYLLEAAETHDDVISNPSDLPRSLVMPTSLVPYHSETPAKKMSLSSISSVGGPNAYAAFRPNSKPDGAN
- Storage temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:ADAMTS3 (NP_055058.1, 1048 a.a. ~ 1128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Size:200 μl
- Pk:200 µl
Specifications
About this item
Mouse monoclonal antibody raised against a partial recombinant ADAMTS3.
Type: Primary
Antigen: ADAMTS3
Clonality: Monoclonal
Clone: 1D6
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a kappa
Reactivity: Human