Anti-KCNJ5 Mouse Monoclonal Antibody [clone: 8D2]
Catalog # ABNOH00003762-M01
Supplier: Abnova
Specifications
- Antibody type:Primary
- Antigen name:Potassium Inwardly-rectifying Channel Subfamily J Member 5
- Antigen symbol:KCNJ5
- Clonality:Monoclonal
- Clone:8D2
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG2a kappa
- Reactivity:Human
- Western blot:Yes
- Environmentally Preferable:
- Cross adsorption:No
- Format:Liquid
- Gene ID:3762
- Antigen synonyms:CIR|KATP1|LQT13|GIRK4|KIR3.4
- Amino acid number:321 to 419
- Storage buffer:1x PBS, pH 7,4
- Sequence:SYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTPSCCAKELAEMKREGRLLQYLPSPPLLGGCAEAGLDAEAEQNEEDEPKGLGGSREARGSV
- Storage temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:KCNJ5 (NP_000881.3, 321 a.a. ~ 419 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Size:100 µg
- Pk:100 µg
Specifications
About this item
Mouse monoclonal antibody raised against a partial recombinant KCNJ5.
Recommended Dilutions: Western Blot: 1-5 ?g/ml
Type: Primary
Antigen: KCNJ5
Clonality: Monoclonal
Clone: 8D2
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a kappa
Reactivity: Human