Anti-TPM1 Rabbit Polyclonal Antibody
ABNOPAB19961
: Abnova
- Antibody type:Primary
- Antigen name:Tropomyosin 1
- Antigen symbol:TPM1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG
- Reactivity:Human
- Western blot:Yes
- Environmentally Preferable:
- Cross adsorption:No
- Format:Liquid
- Gene ID:7168
- Antigen synonyms:TMSA|C15orf13|HEL-S-265|HTM-alpha|LVNC9|CMD1Y|CMH3
- Amino acid number:128 to 243
- Storage buffer:PBS, pH 7,5 (40% glycerol, 0,02% sodium azide)
- Sequence:KVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGQVRQLEEQLRIMDQTLKALMAAEDKYSQKEDRYEEEIKVLSDKLKEAETRAEFAE
- Storage temperature:Store at 4 °C. For long term storage store at –20 °C. Aliquot to avoid repeated freezing and thawing.
- Immunogen:Recombinant protein corresponding to amino acids 128-243 of human TPM1.
- Purification:Antigen affinity purification
- Size:100 μl
- Pk:100 µl
Rabbit polyclonal antibody raised against recombinant TPM1.
Recommended Dilutions: Immunohistochemistry: 1:50-1:200; Western Blot: 1:250-1:500; Immunofluorescence: 1-4 ?g/ml
Type: Primary
Antigen: TPM1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human