Anti-LETM1 and EF-hand Domain Containing Protein 1, Mitochondrial Mouse Monoclonal Antibody [clone: 6F7]
Catalog # USBI129063
Supplier: US Biological
Specifications
- Antibody type:Primary
- Antigen name:LETM1 and EF-hand Domain Containing Protein 1, Mitochondrial
- Clonality:Monoclonal
- Clone:6F7
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- ImmunoFluorescence:Yes
- ImmunoPrecipitation:Yes
- Isotype:IgG1 kappa
- Reactivity:Human
- Western blot:Yes
- Environmentally Preferable:
- Form:liquid
- Amino acid number:601 to 708
- Storage buffer:PBS, pH 7,2.
- Sequence:ESKASKRLTKRVQQMIGQIDGLISQLEMDQQAGKLAPANGMPTGENVISVAELINAMKQVKHIPESKLTSLAAALDENKDGKVNIDDLVKVIELVDKEDVHISTSQVA
- Storage temperature:Cool
- Shipping temperature:Ice
- Purification:purified by Protein A chromatography
- Size:100 µg
- Pk:100 µG
Specifications
About this item
Recommended dilution: Immunofluorescence: 10 ?g/ml; Immunochemistry: 3?g/ml
Type: Primary
Antigen: LETM1 and EF-hand Domain Containing Protein 1, Mitochondrial
Clonality: monoclonal
Clone: 6F7
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG1 Kappa
Reactivity: Human