Anti-CCDC132 Mouse Monoclonal Antibody [clone: 2D11]
Catalog # ABNOH00055610-M01A
Supplier: Abnova
Specifications
- Antibody type:Primary
- Antigen name:VPS50 EARP/GARPII complex subunit
- Antigen symbol:CCDC132
- Clonality:Monoclonal
- Clone:2D11
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG2b kappa
- Reactivity:Human,Mouse
- Western blot:Yes
- Environmentally Preferable:
- Cross adsorption:No
- Form:Liquid
- Gene ID:55610
- Antigen synonyms:CCDC132|VPS54L
- Storage buffer:In ascites fluid
- Sequence:GYANVKKCSNEGRALMQLDFQQFLMKLEKLTDIRPIPDKEFVETYIKAYYLTENDMERWIKEHREYSTKQLTNLVNVCLGSHINKKARQKLLAAIDDIDRPKR
- Storage temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Shipping temperature:Ice
- Immunogen:FLJ20097 (NP_060137, 862 a.a. ~ 964 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Size:200 µl
- Pk:200 µl
Specifications
About this item
Type: Primary
Antigen: CCDC132
Clonality: Monoclonal
Clone: 2D11
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2b kappa
Reactivity: Human, Mouse