Anti-GTF2F2 Rabbit Monoclonal Antibody [clone: ARC2513]
ANTIA306881-100
New Product
- Antibody type:Primary
- Antigen name:ATP dependent helicase GTF2F2
- Antigen symbol:GTF2F2
- Clonality:Monoclonal
- Clone:ARC2513
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Environmentally Preferable:
- Form:Liquid
- Gene ID:UniprotID# P13984
- Antigen synonyms:General transcription factor IIF subunit 2|General transcription factor IIF, polypeptide 2, 30kDa|T2FB_HUMAN|RAP30|General transcription factor IIF polypeptide 2|ATP-dependent helicase GTF2F2|TFIIF|General transcription factor IIF 30 kDa subunit|BTF4
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:30 kDa
- Sequence:MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGRTEVSFTLNEDLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESS
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GTF2F2 (P13984).
- Tested applications:IHC
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit monoclonal [ARC2513] antibody to GTF2F2 for WB and IHC with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, IHC
- Recommended Dilutions: WB: 1:500 to 1:1000, IHC: 1:50 to 1:200
Type: Primary
Antigen: GTF2F2
Clonality: Monoclonal
Clone: ARC2513
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat