Anti-ABCD11 Rabbit Polyclonal Antibody
Catalog # ABNOPAB20205
Supplier: Abnova
Specifications
- Antibody type:Primary
- Antigen name:ATP-binding cassette, Subfamily D (ALD), Member 11
- Antigen symbol:ABCD11
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Environmentally Preferable:
- Cross adsorption:No
- Format:Liquid
- Gene ID:5826
- Antigen synonyms:ABC41|EST352188|PMP69|sub-family D|peroxisomal membrane protein 1-like|P79R|member 4|P70R|sub-family D (ALD)|ABCD4|PXMP1L|ATP-binding cassette
- Storage buffer:PBS, pH 7,5 (40% glycerol, 0,02% sodium azide)
- Sequence:TLVSKNAFVCIYLISCFTQLIDLSTTLSDVAGYTHRIGQLRETLLDMSLKSQDCEILGESEWGLDTPPGWPAAEPADTAFLLERVSISAPSSDKPLIKDLSLKISEGQSLLITGNTGTGK
- Storage temperature:Store at 4 °C. For long term storage store at –20 °C. Aliquot to avoid repeated freezing and thawing.
- Immunogen:Recombinant protein corresponding to amino acids of human ABCD4.
- Purification:Antigen affinity purification
- Size:100 μl
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody raised against recombinant ABCD4.
Recommended Dilutions: Immunohistochemistry: 1:200-1:500
Type: Primary
Antigen: ABCD11
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human