Anti-Sulfite oxidase Rabbit Monoclonal Antibody [clone: ARC2535]
Catalog # ANTIA306351-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Antibody type:Primary
- Antigen name:EC 1.8.3.1
- Antigen symbol:Sulfite oxidase
- Clonality:Monoclonal
- Clone:ARC2535
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Rat
- Western blot:Yes
- Environmentally Preferable:
- Form:Liquid
- Gene ID:UniprotID# P51687
- Antigen synonyms:SUOX|Sulfite oxidase mitochondrial|mitochondrial|Sulfite oxidase, mitochondrial precursor|Sulfite oxidase|SUOX_HUMAN
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:60 kDa
- Sequence:IWVTLGSEVFDVTEFVDLHPGGPSKLMLAAGGPLEPFWALYAVHNQSHVRELLAQYKIGELNPEDKVAPTVETSDPYADDPVRHPALKVNSQRPFNAEPPP
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SUOX (P51687).
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC2535] antibody to Sulfite oxidase for WB with samples derived from Rat.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:1000
Type: Primary
Antigen: Sulfite oxidase
Clonality: Monoclonal
Clone: ARC2535
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Rat
Frequently Bought Together