Anti-SP140 Mouse Monoclonal Antibody [clone: 3F9]
Catalog # ABNOH00011262-M07
Supplier: Abnova
Specifications
- Antibody type:Primary
- Antigen name:SP140 Nuclear Body Protein
- Antigen symbol:SP140
- Clonality:Monoclonal
- Clone:3F9
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG2a kappa
- Reactivity:Human
- Environmentally Preferable:
- Cross adsorption:No
- Form:Liquid
- Gene ID:11262
- Antigen synonyms:LYSP100-B|LYSP100|LYSP100-A
- Storage buffer:In 1X PBS, pH 7,4
- Sequence:GHGWSRMRMRRQKNSQQNDNSKADGQVVSSEKKANVNLKDLSKIRGRKRGKPGTRFTQSDRAAQKRVRSRASRKHKDETVDFKAPLLPVTCGGVKGILHKKKLQQGILV
- Storage temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Shipping temperature:Ice
- Immunogen:SP140 (NP_009168.3, 504 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
- Size:100 µg
- Pk:100 µg
Specifications
About this item
Mouse monoclonal antibody raised against a partial recombinant SP140.
Recommended Dilutons: Western Blot (1 to 5 µg/ml).
Type: Primary
Antigen: SP140
Clonality: Monoclonal
Clone: 3F9
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a kappa
Reactivity: Human