Anti-EPS15 Rabbit Polyclonal Antibody
Rabbit polyclonal antibody to EPS15 for WB with samples derived from Human and Mouse.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:200
Type: Primary
Antigen: EPS15
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.
To order chemicals, medical devices, or other restricted products, please provide identification that includes your business name and shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of identification are:
- • Issued document with your organization's Federal Tax ID Number
- • Government issued document with your organization's Resale Tax ID Number
- • Any other Government ID that includes the business name and address
Avantor will not lift restrictions for residential shipping addresses.
- Catalog No:
- 76866-412
- Antigen symbol:
- EPS15
- Antigen name:
- AF 1P
- Antigen synonyms:
- Epidermal growth factor receptor substrate 15|Epidermal growth factor receptor pathway substrate 15|MLLT 5|MLLT5|AF 1p protein|EPS 15|EPS15|ALL1 fused gene from chromosome 1|AF1P
- Antibody type:
- Primary
- Clonality:
- Polyclonal
- Conjugation:
- Unconjugated
- Reactivity:
- Human, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# P42566
- Isotype:
- IgG
- Western blot:
- Yes
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 660-840 of human EPS15 (NP_001972.1)
- Sequence:
- RQSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDSPDPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADP
- Molecular weight:
- 150kDa
- Purification:
- Affinity purification.
- Storage buffer:
- Supplied in Phosphate buffered saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol
- Storage temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at ‒20 °C. Avoid freeze / thaw cycles.
- Shipping temperature:
- Shipped on blue ice at +4 °C
Frequently Bought Together