Anti-PI4KA Rabbit Polyclonal Antibody
Supplier: ANTIBODIES.COM LLC
Certificates
About this item
Rabbit polyclonal antibody to PI4KA for WB and ICC/IF with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, ICC/IF
- Recommended Dilutions: WB: 1:500 to 1:2,000, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: PI4KA
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.
To order chemicals, medical devices, or other restricted products, please provide identification that includes your business name and shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of identification are:
- • Issued document with your organization's Federal Tax ID Number
- • Government issued document with your organization's Resale Tax ID Number
- • Any other Government ID that includes the business name and address
Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Catalog No:
- 77228-712
- Antigen symbol:
- PI4KA
- Antigen name:
- EC 2.7.1.67
- Antigen synonyms:
- PI4 kinase|PI4K ALPHA|Phosphatidylinositol 4 kinase III alpha|Phosphatidylinositol 4 kinase catalytic alpha polypeptide|Phosphatidylinositol 4 kinase alpha|PI4K-alpha|PI4-kinase alpha|pi4K230|Phosphatidylinositol 4-kinase alpha
- Antibody type:
- Primary
- Clonality:
- Polyclonal
- Conjugation:
- Unconjugated
- Reactivity:
- Human, Rat, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# P42356
- Isotype:
- IgG
- Western blot:
- Yes
- ImmunoChemistry:
- Yes
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 1780-1860 of human PI4KA (P42356)
- Sequence:
- PEAIVLDIDYKSGTPMQSAAKAPYLAKFKVKRCGVSELEKEGLRCRSDSEDECSTQEADGQKISWQAAIFKVGDDCRQDML
- Form:
- Liquid
- Molecular weight:
- 237 kDa
- Purification:
- Affinity purification
- Storage buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal
- Storage temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:
- Shipped on blue ice at 4 °C
- Tested applications:
- ICC/IF
Specifications
Frequently Bought Together