Anti-Ahsp Rabbit Polyclonal Antibody
Catalog # 76858-404
Supplier: Avantor
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.
To order chemicals, medical devices, or other restricted products, please provide identification that includes your business name and shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of identification are:
- • Issued document with your organization's Federal Tax ID Number
- • Government issued document with your organization's Resale Tax ID Number
- • Any other Government ID that includes the business name and address
Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody type:Primary
- Antigen name:Ahsp
- Antigen symbol:Ahsp
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Rat,Mouse
- Western blot:Yes
- Size:50 µl
- Environmentally Preferable:
- Form:Liquid
- Gene ID:UniprotID# Q9NZD4
- Antigen synonyms:Erythroid differentiation associated factor|Erythroid associated factor|ERAF|Erythroid differentiation-related factor|Alpha hemoglobin stabilizing protein|EDRF|AHSP_HUMAN|Erythroid differentiation related factor|Alpha-hemoglobin-stabilizing protein
- Storage buffer:Supplied in Phosphate buffered saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide
- Molecular weight:12 kDa
- Sequence:MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at ‒20 °C. Avoid freeze / thaw cycles.
- Shipping temperature:Shipped on blue ice at +4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-102 of human AHSP (NP_057717.1)
- Purification:Affinity purification.
- Cat. no.:76858-404
- Packaging:Plastic vial
Specifications
About this item
Rabbit polyclonal antibody to Ahsp for WB with samples derived from Mouse and Rat.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:200
Type: Primary
Antigen: Ahsp
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Mouse;Rat
Frequently Bought Together