Anti-HNF1 alpha Rabbit Monoclonal Antibody [clone: ARC55848]
Supplier: ANTIBODIES.COM LLC
Certificates
About this item
Rabbit monoclonal [ARC55848] antibody to HNF1 alpha for IHC with samples derived from Human, Mouse and Rat.
- Validated Applications: IHC
- Recommended Dilutions: IHC: 1:50 to 1:200
Type: Primary
Antigen: HNF1 alpha
Clonality: Monoclonal
Clone: ARC55848
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.
To order chemicals, medical devices, or other restricted products, please provide identification that includes your business name and shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of identification are:
- • Issued document with your organization's Federal Tax ID Number
- • Government issued document with your organization's Resale Tax ID Number
- • Any other Government ID that includes the business name and address
Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Catalog No:
- 77220-218
- Antigen symbol:
- HNF1 alpha
- Antigen name:
- Albumin proximal factor
- Antigen synonyms:
- Hepatic transcription factor 1|HNF-1A|HNF 1|Hepatic nuclear factor 1|Hepatic transcription factor 1 alpha|HNF 1A|HNF-1-alpha|Hepatocyte nuclear factor 1-alpha|Hepatic nuclear factor 1 alpha
- Antibody type:
- Primary
- Clonality:
- Monoclonal
- Conjugation:
- Unconjugated
- Clone:
- ARC55848
- Reactivity:
- Human, Rat, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# P20823
- Isotype:
- IgG
- ImmunoChemistry:
- Yes
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 31-128 of human HNF1a (NP_000536.6).
- Sequence:
- GEPGPYLLAGEGPLDKGESCGGGRGELAELPNGLGETRGSEDETDDDGEDFTPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNI
- Form:
- Liquid
- Purification:
- Affinity purification
- Storage buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300
- Storage temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:
- Shipped on blue ice at 4 °C
- Tested applications:
- IHC
Specifications
Related Information
Frequently Bought Together
VWR® Disposable Serological Pipettes
Supplier: VWR International
VWR® Nitrile Examination Gloves, Blue
Supplier: VWR International
Falcon® Centrifuge Tubes, Conical Bottom, Corning
Supplier: Corning
VWR® Disposable Petri Dishes
Supplier: VWR International
VWR® Universal Pipette Tips
Supplier: VWR International
pH Reference Standard Buffers, VWR Chemicals BDH®
Supplier: BDH