About this item
Rabbit monoclonal [ARC2465] antibody to Keratin 12/K12 for WB, IHC and ICC/IF with samples derived from Mouse and Rat.
- Validated Applications: WB, IHC, ICC/IF
- Recommended Dilutions: WB: 1:100 to 1:500, IHC: 1:50 to 1:200, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: Keratin 12 / K12
Clonality: Monoclonal
Clone: ARC2465
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Mouse;Rat
To order chemicals, medical devices, or other restricted products, please provide identification that includes your business name and shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of identification are:
- • Issued document with your organization's Federal Tax ID Number
- • Government issued document with your organization's Resale Tax ID Number
- • Any other Government ID that includes the business name and address
Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Catalog No:
- 77219-346
- Antigen symbol:
- Keratin 12 / K12
- Antibody type:
- Primary
- Clonality:
- Monoclonal
- Conjugation:
- Unconjugated
- Clone:
- ARC2465
- Reactivity:
- Rat, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# Q99456
- Isotype:
- IgG
- Western blot:
- Yes
- ImmunoChemistry:
- Yes
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 250-494 of human Cytokeratin 12 (KRT12) (Q99456).
- Sequence:
- EMQIESLNEELAYMKKNHEDELQSFRVGGPGEVSVEMDAAPGVDLTRLLNDMRAQYETIAEQNRKDAEAWFIEKSGELRKEISTNTEQLQSSKSEVTDLRRAFQNLEIELQSQLAMKKSLEDSLAEAEGDYCAQLSQVQQLISNLEAQLLQVRADAERQNVDHQRLLNVKARLELEIETYRRLLDGEAQGDGLEESLFVTDSKSQAQSTDSSKDPTKTRKIKTVVQEMVNGEVVSSQVQEIEELM
- Form:
- Liquid
- Molecular weight:
- 54 kDa
- Purification:
- Affinity purification
- Storage buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide
- Storage temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:
- Shipped on blue ice at 4 °C
- Tested applications:
- IHC, ICC/IF
Specifications
Related Information
Supplier: BDH
Supplier: VWR International
Supplier: VWR International
Supplier: VWR International
Supplier: VWR International
Supplier: Corning