About this item
Rabbit polyclonal antibody to Transcription factor AP-2-alpha for WB with samples derived from Human and Rat.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:1,000
Type: Primary
Antigen: Transcription factor AP-2-alpha
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Rat
To order chemicals, medical devices, or other restricted products, please provide identification that includes your business name and shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of identification are:
- • Issued document with your organization's Federal Tax ID Number
- • Government issued document with your organization's Resale Tax ID Number
- • Any other Government ID that includes the business name and address
Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Catalog No:
- 77230-268
- Antigen symbol:
- Transcription factor AP-2-alpha
- Antibody type:
- Primary
- Clonality:
- Polyclonal
- Conjugation:
- Unconjugated
- Reactivity:
- Human, Rat
- Host:
- Rabbit
- Gene ID:
- UniprotID# P05549
- Isotype:
- IgG
- Western blot:
- Yes
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Activator protein 2 (AP-2/TFAP2A) (NP_003211.1)
- Sequence:
- RQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNL
- Form:
- Liquid
- Molecular weight:
- 50 kDa
- Purification:
- Affinity purification
- Storage buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300
- Storage temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:
- Shipped on blue ice at 4 °C
Specifications
Related Information
Supplier: VWR International
Supplier: VWR International
Supplier: VWR International
Supplier: VWR International
Supplier: Corning
Supplier: BDH