Anti-EFTUD2 Rabbit Polyclonal Antibody
Supplier: ANTIBODIES.COM LLC
Certificates
About this item
Rabbit polyclonal antibody to EFTUD2 for WB, IHC, ICC/IF and IP with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, IHC, ICC/IF, IP
- Recommended Dilutions: WB: 1:500 to 1:2000, IHC: 1:50 to 1:200, ICC/IF: 1:50 to 1:100, IP: 1:20 to 1:50
Type: Primary
Antigen: EFTUD2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.
To order chemicals, medical devices, or other restricted products, please provide identification that includes your business name and shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of identification are:
- • Issued document with your organization's Federal Tax ID Number
- • Government issued document with your organization's Resale Tax ID Number
- • Any other Government ID that includes the business name and address
Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Catalog No:
- 76854-542
- Antigen symbol:
- EFTUD2
- Antigen name:
- Elongation factor Tu GTP binding domain containing 2
- Antigen synonyms:
- hSNU114|EFTUD2|SNRNP116|Snrp116|MFDGA|Elongation factor Tu GTP-binding domain-containing protein 2|116 kDa|MFDM|116 kDa U5 small nuclear ribonucleoprotein component
- Antibody type:
- Primary
- Clonality:
- Polyclonal
- Conjugation:
- Unconjugated
- Reactivity:
- Human, Rat, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# Q15029
- Isotype:
- IgG
- Western blot:
- Yes
- ImmunoChemistry:
- Yes
- ImmunoPrecipitation:
- Yes
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 1 - 205 of human EFTUD2 (NP_004238.3)
- Sequence:
- MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDKKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDT
- Form:
- Liquid
- Molecular weight:
- 120 kDa
- Purification:
- Affinity purification
- Storage buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide
- Storage temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:
- Shipped on blue ice at 4 °C
- Tested applications:
- IHC, ICC/IF
Specifications
Frequently Bought Together
VWR® Disposable Serological Pipettes
Supplier: VWR International
VWR® Universal Pipette Tips
Supplier: VWR International
pH Reference Standard Buffers, VWR Chemicals BDH®
Supplier: BDH
VWR® Nitrile Examination Gloves, Blue
Supplier: VWR International
VWR® Disposable Petri Dishes
Supplier: VWR International
Falcon® Centrifuge Tubes, Conical Bottom, Corning
Supplier: Corning