Anti-MDC1 Rabbit Polyclonal Antibody
Rabbit polyclonal antibody to MDC1 for WB, IHC and ICC/IF with samples derived from Human.
- Validated Applications: WB, IHC, ICC/IF
- Recommended Dilutions: WB: 1:500 to 1:2000, IHC: 1:50 to 1:200, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: MDC1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.
To order chemicals, medical devices, or other restricted products, please provide identification that includes your business name and shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of identification are:
- • Issued document with your organization's Federal Tax ID Number
- • Government issued document with your organization's Resale Tax ID Number
- • Any other Government ID that includes the business name and address
Avantor will not lift restrictions for residential shipping addresses.
- Catalog No:
- 76854-200
- Antigen symbol:
- MDC1
- Antigen name:
- Homologue to Drosophila photoreceptor protein calphotin
- Antigen synonyms:
- Mediation of DNA damage checkpoint 1|NFBD1|Mediator of DNA damage checkpoint 1|MDC 1|NFBD 1|Nuclear factor with BRCT domains 1|MDC1|Mediator of DNA damage checkpoint protein 1|MDC1_HUMAN
- Antibody type:
- Primary
- Clonality:
- Polyclonal
- Conjugation:
- Unconjugated
- Reactivity:
- Human
- Host:
- Rabbit
- Gene ID:
- UniprotID# Q14676
- Isotype:
- IgG
- Western blot:
- Yes
- ImmunoChemistry:
- Yes
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 1 - 350 of human MDC1 (NP_055456.2)
- Sequence:
- MEDTQAIDWDVEEEEETEQSSESLRCNVEPVGRLHIFSGAHGPEKDFPLHLGKNVVGRMPDCSVALPFPSISKQHAEIEILAWDKAPILRDCGSLNGTQILRPPKVLSPGVSHRLRDQELILFADLLCQYHRLDVSLPFVSRGPLTVEETPRVQGETQPQRLLLAEDSEEEVDFLSERRMVKKSRTTSSSVIVPESDEEGHSPVLGGLGPPFAFNLNSDTDVEEGQQPATEEASSAARRGATVEAKQSEAEVVTEIQLEKDQPLVKERDNDTKVKRGAGNGVVPAGVILERSQPPGEDSDTDVDDDSRPPGRPAEVHLERAQPFGFIDSDTDAEEERIPATPVVIPMKKR
- Form:
- Liquid
- Molecular weight:
- 270 kDa
- Purification:
- Affinity purification
- Storage buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide
- Storage temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:
- Shipped on blue ice at 4 °C
- Tested applications:
- IHC, ICC/IF
Frequently Bought Together
VWR® Light-Duty Tissue Wipers
: VWR International
VWR® Universal Pipette Tips
: VWR International
VWR® Disposable Petri Dishes
: VWR International
VWR® Nitrile Examination Gloves, Blue
: VWR International