Order Entry
Canada
ContactUsLinkComponent
 
Anti-Timeless Rabbit Monoclonal Antibody [Clone: ARC1827]
 
undefined
Anti-Timeless Rabbit Monoclonal Antibody [Clone: ARC1827]
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products, please provide identification that includes your business name and shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of identification are:

  • • Issued document with your organization's Federal Tax ID Number
  • • Government issued document with your organization's Resale Tax ID Number
  • • Any other Government ID that includes the business name and address

Avantor will not lift restrictions for residential shipping addresses.

 

  • Catalog No:
  • 77219-438
  • Antigen symbol:
  • Timeless
  • Antigen name:
  • FLJ12640
  • Antigen synonyms:
  • TIM1|hTIM|Protein timeless homolog|timeless circadian clock 1|TIM_HUMAN|Timeless|FLJ20714|TIMELESS1|timeless circadian clock
  • Antibody type:
  • Primary
  • Clonality:
  • Monoclonal
  • Conjugation:
  • Unconjugated
  • Clone:
  • ARC1827
  • Reactivity:
  • Human
  • Host:
  • Rabbit
  • Gene ID:
  • UniprotID# Q9UNS1
  • Isotype:
  • IgG
  • Western blot:
  • Yes
  • Immunogen:
  • Recombinant fusion protein containing a sequence corresponding to amino acids 1058-1208 of human Timeless (Q9UNS1).
  • Sequence:
  • EQFQQLLRKLGVRPPASGQETFWRIPAKLSPTQLRRAAASLSQPEEEQKLQPELQPKVPGEQGSDEEHCKEHRAQALRALLLAHKKKAGLASPEEEDAVGKEPLKAAPKKRQLLDSDEEQEEDEGRNRAPELGAPGIQKKKRYQIEDDEDD
  • Form:
  • Liquid
  • Molecular weight:
  • 150 kDa
  • Purification:
  • Affinity purification
  • Storage buffer:
  • Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide
  • Storage temperature:
  • Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze / thaw cycles.
  • Shipping temperature:
  • Shipped on blue ice at 4 °C

 

Frequently Bought Together