To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. VWR will not lift restrictions for residential shipping addresses.
Specifications
- Antibody type:Primary
- Antigen name:Acyl-CoA Binding Domain Containing 3
- Clonality:Monoclonal
- Clone:1E10
- Host:Mouse
- Isotype:IgG1 kappa
- Reactivity:Human
- Antigen symbol:ACBD3
- Conjugation:Unconjugated
- ELISA:Yes
- Size:50 µg
- Western blot:Yes
- Cross adsorption:No
- Form:Liquid
- Antigen synonyms:GOCAP 1|Peripherial benzodiazepine receptor associated protein|PAP 7|ACBD 3|Golgi complex associated protein 1 60kDa|GCP60|Golgi phosphoprotein 1|GCP 60|Golgi complex-associated protein 1|Acyl Coenzyme A binding domain containing 3|GOLPH 1|GOCAP1|Acyl CoA binding domain containing protein 3|Peripheral benzodiazepine receptor associated protein PAP7|PKA RIalpha associated protein.|PBR associated protein|ACBD3|PAP7|Golgi complex associated protein 1|GCP60_HUMAN|PBR and PKA associated protein 7|Golgi resident protein GCP60|PBR- and PKA-associated protein 7|Acyl-CoA-binding domain-containing protein 3|Peripheral benzodiazepine receptor-associated protein PAP7|GOLPH1
- Storage buffer:In 1x PBS, pH 7.4
- Sequence:RRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHL
- Storage temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:ACBD3 (NP_073572, 73 a.a. ~ 171 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Cat. no.:10510-128
- Supplier No.:H00064746-M05
Specifications
About this item
Mouse monoclonal antibody raised against a partial recombinant ACBD3.
Recommended Dilutons: Western Blot (1-5 ug/mL)
Type: Primary
Antigen: ACBD3
Clonality: Monoclonal
Clone: 10
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG1 kappa
Reactivity: Human