Anti-MBD3 Mouse Monoclonal Antibody [clone: 995CT3.2.2]
Catalog #: 89513-514
Supplier: Abgent
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.
To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. VWR will not lift restrictions for residential shipping addresses.
Specifications
- Antibody type:Primary
- Antigen name:methyl-CpG binding domain protein 3
- Clonality:Monoclonal
- Clone:995CT3.2.2
- Gene ID:53615
- Host:Mouse
- Isotype:IgG1
- Reactivity:Human
- Antigen symbol:MBD3
- Conjugation:Unconjugated
- ELISA:Yes
- Size:400 µL
- Western blot:Yes
- Epitope:C-Terminal
- Storage buffer:PBS with 0.09% (W/V) sodium azide, pH7.4
- Molecular weight:32.844 kDa
- Sequence:MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKSRQR
VRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIAEELVKTMD
LPKGLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLE
EALMADMLAHVEELARDGE - Storage temperature:Maintain refrigerated at 2-8 °C for up to 6 months. For long term storage store at –20 °C in small aliquots to prevent freeze-thaw cycles
- Concentration:0.5mg/ml
- Shipping temperature:4 °C
- Immunogen:Purified His-tagged MBD3 protein was used to produced this monoclonal antibody.
- Purification:Protein G Purification
- Cat. no.:89513-514
- Supplier No.:AM2203B
Specifications
About this item
Western Blot: 1:1000
Type: Primary
Antigen: MBD3
Clonality: Monoclonal
Clone: 995CT3.2.2
Conjugation: Unconjugated
Epitope: C-terminal
Host: Mouse
Isotype: IgG1
Reactivity: Human
Customers Who Bought This Also Bought