To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. VWR will not lift restrictions for residential shipping addresses.
Specifications
- Antibody type:Primary
- Antigen name:DEAH (Asp-Glu-Ala-His) box polypeptide 34
- Clonality:Polyclonal
- Gene ID:9704
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Antigen symbol:DHX34
- Conjugation:Unconjugated
- Size:50 μg
- Western blot:Yes
- Antigen synonyms:1810012L18Rik|mKIAA0134|Ddx34|1200013B07Rik|HRH1
- Storage buffer:Phosphate buffered saline (PBS)
- Storage temperature:Store at 4 °C for short-term use. For longer periods of storage, aliquot and store at –20 °C. Avoid repeat freeze-thaw cycles.
- Concentration:1 mg/ml
- Immunogen:Synthetic peptide located within the following region: APQDGPPGAEEAALETLQKTSVLQRPYHCEACGKDFLFTPTEVLRHRKQH
- Purification:Peptide Affinity Purified
- Cat. no.:89270-766
- Supplier No.:GTX47515
Specifications
About this item
Rabbit polyclonal antibody to DHX34 (Middle)
Recommended Dilutions: For Western Blot: Use at 1 ug/ml.
Not yet tested in other applications. Optimal dilutions should be determined experimentally by the researcher.
Type: Primary
Antigen: DHX34
Clonality: Polyclonal
Clone:
Conjugation:
Epitope:
Host: Rabbit
Isotype:
Reactivity: Human