To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. VWR will not lift restrictions for residential shipping addresses.
Specifications
- Antibody type:Primary
- Antigen name:Galanin
- Clonality:Polyclonal
- Gene ID:51083
- Host:Mouse
- Isotype:IgG
- Reactivity:Chicken,Bovine,Rat,Mouse
- Antigen symbol:GALN
- Conjugation:Unconjugated
- ELISA:Yes
- ImmunoChemistry:Yes
- Size:100 μg
- Western blot:Yes
- Antigen synonyms:GALN|GMAP|MGC40167|GLNN |GAL1 |galanin
- Storage buffer:10 mM PBS, pH 7.4 with 10 mg/ml BSA and 0.1% sodium azide
- Storage temperature:Store at 4 °C for up to two weeks. For long term storage, aliquot and store at –20 °C, avoid freeze/thaw cycles.
- Concentration:0.50 mg/ml
- Immunogen:GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS.
- Purification:Antigen affinity purification
- Cat. no.:89294-934
- Supplier No.:GTX37691
Specifications
About this item
Mouse polyclonal antibody to Galanin
P-ELISA:1:500-1000, WB:1:100-500, IHC-P:1:100-500 (based on 0.5 mg/ml)
Type: Primary
Antigen: GAL
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG
Reactivity: Human, Mouse, Rat, Guinea Pig, Bovine