To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. VWR will not lift restrictions for residential shipping addresses.
Specifications
- Antibody type:Primary
- Antigen name:Presenilin 2 loop region
- Clonality:Polyclonal
- Host:Rabbit
- Isotype:IgG
- Antigen symbol:PSNL2
- Conjugation:Unconjugated
- ImmunoPrecipitation:Yes
- Size:500 µg
- Western blot:Yes
- Epitope:Human PS1 [306-334] in the loop region
- Cross adsorption:No
- Format:Lyophilized
- Antigen synonyms:STM-2|E5-1|AD3LP|AD5
- Immunogen:A synthetic peptide (KLDPSSQGALQLPYDPEMEEDSYDSFGEP-C) corresponding to human PS1 [306-334] in the loop region conjugated via additional C-terminal Cys to Diphtheria toxoid.
- Cat. no.:10782-556
- Supplier No.:R-1681-500
Specifications
About this item
Autosomal dominant mutations in presenilin 2 are the second major cause of early-onset familial Alzheimer's disease. Presenilin 2 is a multi-transmembrane protein which undergoes endoprotelysis to form an N-terminal fragment of about 29 kDa and C-terminal fragment of about 22 kDa. Presenilin 2 forms the catalytic core of the gamma-secretase complex which cleaves type 1 transmembrane proteins including the amyloid precursor protein to generate the C-terminus of the amyloid beta peptide.
Confirmed by Western blot using mouse and human brain and knock down of presenilin 2 in vitro using siRNA see ref 6 below. Not reactive with presenilin 1.
Application Information:
WB and IP. Suggested dilution of 1:1,000 is recommended for WB. Full length presenilin 2 (448 aa) has relative MW of about 45 kDa, with this antibody most commonly detected as cleaved CTF of 22 kDa with this antibody. Human or mouse brain samples commonly prepared with reducing agent (50mM DTT), urea (2.3 M), SDS (1.5%) in 62.5 mM Tris-HCL pH 6.8 sample buffer (without boiling) heating to 50 C for 15 min. The suggested dilution for IP is 1:100 . Biosensis recommends that the optimal working dilution should be determined by the end user.
Type: Primary
Antigen: Presenilin 2 loop region
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope: Human PS1 [306-334] in the loop region
Host: Rabbit
Isotype: IgG
Reactivity: