Anti-GTSF1L Mouse Monoclonal Antibody [clone: 5E7]
10585-614
: Abnova
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.
To order chemicals, medical devices, or other restricted products, please provide identification that includes your business name and shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of identification are:
- • Issued document with your organization's Federal Tax ID Number
- • Government issued document with your organization's Resale Tax ID Number
- • Any other Government ID that includes the business name and address
Avantor will not lift restrictions for residential shipping addresses.
- Antibody type:Primary
- Antigen name:gametocyte specific factor 1-like
- Antigen symbol:GTSF1L
- Clonality:Monoclonal
- Clone:5E7
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG2a kappa
- Reactivity:Human
- Western blot:Yes
- Size:100 µg
- Environmentally Preferable:
- Cross adsorption:No
- Format:Liquid
- Gene ID:149699
- Antigen synonyms:FAM112A|dJ1028D15.4|C20orf65
- Amino acid number:1 to 148
- Storage buffer:1x PBS, pH 7.4
- Sequence:MEPEAFEICPYDPHHRIPLSRFQYHLASCRRKNPKKAKKMATCKYNACHVVPIKNLEEHEAVCVNRSAVEEEDTENPLKVSPPSSEQNDDTQQVSPCLPSPDIWNVDGANCQHVFVLKTFFPQKVVCENDTKESARETSPQKILRPGQ
- Storage temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:GTSF1L (NP_789761.1, 1 a.a. ~ 148 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Cat. no.:10585-614
- Supplier No.:H00149699-M03
Mouse monoclonal antibody raised against a full-length recombinant GTSF1L.
Recommended Dilutions: Western Blot: 1-5 ?g/ml
Type: Primary
Antigen: GTSF1L
Clonality: Unconjugated
Clone: Monoclonal
Conjugation: 5E7
Epitope:
Host: IgG2a kappa
Isotype: Mouse
Reactivity: Human