Order Entry
ContactUsLinkComponent
PDKtide, Biotin
PDKtide, Biotin
Catalog #: 89161-158
Supplier:  Enzo Life Sciences
CAS Number:  
Pdktide Peptide Substrate (Biotinylated) 100 ug
PDKtide, Biotin
Catalog #: 89161-158
Supplier:  Enzo Life Sciences
CAS Number:  
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

  • • State issued document with your organization's Federal Tax ID Number
  • • State issued document with your organization's Resale Tax ID Number
  • • City or County issued Business License
  • • State Department of Health Services License
  • • Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. VWR will not lift restrictions for residential shipping addresses.

Specifications

  • Conjugation:
    Biotin
  • Size:
    100 µg
  • Protein/peptide name:
    PDKtide
  • Purity:
    95%
  • Cat. no.:
    89161-158
  • Supplier No.:
    P251-0100

Specifications

About this item

Protein kinase substrate

This peptide, Biotin-Ahx-KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC, is derived from AKT1 and PKN2/PRK2. It is a substrate for PDK1, CDK9/Cyclin T1 and JAK2.The biotin allows peptide to be used in kinase assays with streptavidin-bound membranes.

Customers Who Bought This Also Bought