Anti-Pdha2 Rabbit Polyclonal Antibody
ANTIA93155-100
New Product
- Type d'anticorps:Primaire
- Nom de l'antigène:EC 1.2.4.1
- Symbole de l'antigène:Pdha2
- Clonalité:Polyclonal
- Conjugaison:Unconjugated
- Hôte:Rabbit
- ImmunoChimie:Yes
- Isotype:IgG
- Réactivité:Rat,Mouse
- Western blot:Yes
- Environmentally Preferable:
- Formulaire:Liquid
- ID de gène:UniprotID# P35487
- Synonymes antigène:PDHAL|PDHE1 A type II|Pyruvate dehydrogenase (lipoamide) alpha 2|MGC149517|PDHA2|ODPAT_HUMAN|MGC149518|mitochondrial|PDHE1-A type II
- Storage buffer:Supplied in Phosphate Buffered Saline, pH 7,3, with 50% Glycerol and 0,01% Thiomersal
- Molecular weight:43 kDa
- Sequence:ISYRSREEVHNVRSKSDPIMLLRERIISNNLSNIEELKEIDADVKKEVEDAAQFATTDPEPAVEDIANYLYHQDPPFEVRGAHKWLKYKSHS
- Température de stockage:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Température de transport:Shipped on blue ice at 4 °C
- Immunogène:A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of mouse PDHA2 (NP_032837.1)
- Tested applications:IHC
- Purification:Affinity purification
- Type de conditionnement:Plastic vial
- Cdt:100 µl
Rabbit polyclonal antibody to Pdha2 for WB and IHC with samples derived from Mouse and Rat.
- Validated applications: WB, IHC
- Recommended dilutions: WB: 1:500 to 1:2,000, IHC: 1:50 to 1:200
Type: Primary
Antigen: Pdha2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Mouse, Rat