Anti-USP14/TGT Rabbit Monoclonal Antibody [clone: ARC2185]
ANTIA308550-100
New Product
- Type d'anticorps:Primaire
- Symbole de l'antigène:USP14/TGT
- Clonalité:Monoclonal
- Clone:ARC2185
- Conjugaison:Unconjugated
- Hôte:Rabbit
- Précipitation immunologique:Yes
- Isotype:IgG
- Réactivité:Human,Rat,Mouse
- Western blot:Yes
- Environmentally Preferable:
- Formulaire:Liquid
- ID de gène:UniprotID# P54578
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:56 kDa
- Sequence:RSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWH
- Température de stockage:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Température de transport:Shipped on blue ice at 4 °C
- Immunogène:Recombinant fusion protein containing a sequence corresponding to amino acids 371-473 of human USP14 (P54578)
- Purification:Affinity purification
- Type de conditionnement:Plastic vial
- Cdt:100 µl
Rabbit monoclonal [ARC2185] antibody to USP14/TGT for WB and IP with samples derived from human, mouse and rat.
- Validated applications: WB, IP
- Recommended dilutions: WB: 1:500 to 1:2,000, IP: 1:1,000 to 1:5,000
Type: Primary
Antigen: USP14/TGT
Clonality: Monoclonal
Clone: ARC2185
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat