Anti-Alpha Taxilin Rabbit Polyclonal Antibody
Catalogus # ANTIA307469-100
Leverancier: ANTIBODIES.COM
New Product
Specificaties
- Type d'anticorps:Primaire
- Symbole de l'antigène:Alpha Taxilin
- Clonalité:Polyclonal
- Conjugaison:Unconjugated
- Hôte:Rabbit
- ImmunoChimie:Yes
- Isotype:IgG
- Réactivité:Human
- Western blot:Yes
- Environmentally Preferable:
- Formulaire:Liquid
- ID de gène:UniprotID# P40222
- Synonymes antigène:IL14|DKFZp451J0118|MGC118871|RP4-622L5.4|MGC11887|interleukin 14|IL 14|MGC118870|Alpha-taxilin
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol and 0,05% Proclin 300
- Molecular weight:75 kDa
- Sequence:MKNQDKKNGAAKQSNPKSSPGQPEAGPEGAQERPSQAAPAVEAEGPGSSQAPRKPEGAQARTAQSGALRDVSEELSRQLEDILSTYCVDNNQGGPGEDGAQGEPAEPEDAEKSRTYVARNGEPEPTPVVNGEKEPSKGDPNTEEIRQSDEVGDRDHRRPQ
- Température de stockage:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Température de transport:Shipped on blue ice at 4 °C
- Immunogène:Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human TXLNA (NP_787048.1).
- Tested applications:ICC/IF
- Purification:Affinity purification
- Type de conditionnement:Plastic vial
- Cdt:100 µl
Specificaties
Over dit artikel
Rabbit polyclonal antibody to Alpha Taxilin for WB and ICC/IF with samples derived from Human.
- Validated Applications: WB, ICC/IF
- Recommended Dilutions: WB: 1:500 to 1:1000, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: Alpha Taxilin
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human