Anti-Proteasome 20S LMP7 Rabbit Polyclonal Antibody
ANTIA306731-100
New Product
- Type d'anticorps:Primaire
- Nom de l'antigène:ALDD
- Symbole de l'antigène:Proteasome 20S LMP7
- Clonalité:Polyclonal
- Conjugaison:Unconjugated
- Hôte:Rabbit
- ImmunoChimie:Yes
- Isotype:IgG
- Réactivité:Human,Rat,Mouse
- Western blot:Yes
- Environmentally Preferable:
- Formulaire:Liquid
- ID de gène:UniprotID# P28062
- Synonymes antigène:D6S216E|Low molecular mass protein 7|Macropain subunit C13|LMP 7|Large multifunctional protease 7|LMP7|Low molecular weight protein 7|Large multifunctional peptidase 7|D6S216
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol and 0,01% Thiomersal
- Molecular weight:23 kDa
- Sequence:LSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ
- Température de stockage:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Température de transport:Shipped on blue ice at 4 °C
- Immunogène:Recombinant fusion protein containing a sequence corresponding to amino acids 163-272 of human PSMB8 (NP_004150.1).
- Tested applications:IHC, ICC/IF
- Purification:Affinity purification
- Type de conditionnement:Plastic vial
- Cdt:100 µl
Rabbit polyclonal antibody to Proteasome 20S LMP7 for WB, IHC and ICC/IF with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, IHC, ICC/IF
- Recommended Dilutions: WB: 1:500 to 1:2000, IHC: 1:50 to 1:200, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: Proteasome 20S LMP7
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat