Anti-EPS15 Rabbit Polyclonal Antibody
Catalog # ANTIA12399-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Type d'anticorps:Primaire
- Nom de l'antigène:AF 1P
- Symbole de l'antigène:EPS15
- Clonalité:Polyclonal
- Conjugaison:Unconjugated
- Hôte:Rabbit
- Isotype:IgG
- Réactivité:Human,Mouse
- Western blot:Yes
- Environmentally Preferable:
- ID de gène:UniprotID# P42566
- Synonymes antigène:Epidermal growth factor receptor substrate 15|Epidermal growth factor receptor pathway substrate 15|MLLT 5|MLLT5|AF 1p protein|EPS 15|EPS15|ALL1 fused gene from chromosome 1|AF1P
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,30, with 0,02% Sodium Azide and 50% Glycerol
- Molecular weight:150kDa
- Sequence:RQSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDSPDPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADP
- Température de stockage:Shipped at 4 °C. Upon delivery aliquot and store at ‒20 °C. Avoid freeze / thaw cycles.
- Température de transport:Shipped on blue ice at 4 °C
- Immunogène:Recombinant fusion protein containing a sequence corresponding to amino acids 660-840 of human EPS15 (NP_001972.1)
- Purification:Affinity purification.
- Type de conditionnement:Plastic vial
- Cdt:100 µl
Specifications
About this item
Rabbit polyclonal antibody to EPS15 for WB with samples derived from human and mouse.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:200
Type: Primary
Antigen: EPS15
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse