Anti-TOB2 Rabbit Polyclonal Antibody
N° de catalogue ANTIA12094-100
Fournisseur: ANTIBODIES.COM
New Product
Spécifications
- Type d'anticorps:Primaire
- Nom de l'antigène:KIAA1663
- Symbole de l'antigène:TOB2
- Clonalité:Polyclonal
- Conjugaison:Unconjugated
- Hôte:Rabbit
- ImmunoChimie:Yes
- Isotype:IgG
- Réactivité:Human,Rat,Mouse
- Western blot:Yes
- Environmentally Preferable:
- Formulaire:Liquid
- ID de gène:UniprotID# Q14106
- Synonymes antigène:Transducer of ERBB2, 2|Protein Tob4|Transducer of erbB-2 2|TROB2|Protein Tob2|TOB2_HUMAN|Transducer of erbB 2 2
- Storage buffer:Supplied in Phosphate Buffered Saline, pH 7,3, with 50% Glycerol and 0,02% Sodium Azide
- Molecular weight:37 kDa
- Sequence:MQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLKKKYEGHWYPEKPLKGSGFRCVHIGEMVDPVVEL
- Température de stockage:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Température de transport:Shipped on blue ice at 4 °C
- Immunogène:Recombinant fusion protein containing a sequence corresponding to amino acids 1 - 70 of human TOB2 (NP_057356.1)
- Tested applications:IHC, ICC/IF
- Purification:Affinity purification
- Type de conditionnement:Plastic vial
- Cdt:100 µl
Spécifications
À propos de cet article
Rabbit polyclonal antibody to TOB2 for WB, IHC and ICC/IF with samples derived from human, mouse and rat.
- Validated applications: WB, IHC, ICC/IF
- Recommended dilutions: WB: 1:500 to 1:2000, IHC: 1:100 to 1:200, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: TOB2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat