Anti-AARS2 Rabbit Polyclonal Antibody
N° de catalogue ANTIA10232-100
Fournisseur: ANTIBODIES.COM
New Product
Spécifications
- Type d'anticorps:Primaire
- Nom de l'antigène:Alanine tRNA ligase 2 mitochondrial
- Symbole de l'antigène:AARS2
- Clonalité:Polyclonal
- Conjugaison:Unconjugated
- Hôte:Rabbit
- Isotype:IgG
- Réactivité:Human
- Western blot:Yes
- Environmentally Preferable:
- Formulaire:Liquid
- ID de gène:UniprotID# Q5JTZ9
- Synonymes antigène:AlaRS|AARSL|AARS 2|Alanine tRNA ligase|Alanyl tRNA synthetase 2 mitochondrial|bA444E17.1|Alanyl-tRNA synthetase 2|AARS2|Alanyl tRNA synthetase like
- Storage buffer:Supplied in Phosphate Buffered Saline, pH 7,3, with 50% Glycerol and 0,02% Sodium Azide
- Molecular weight:107 kDa
- Sequence:RRELLATVKMLQRRANTAIRKLQMGQAAKKTQELLERHSKGPLIVDTVSAESLSVLVKVVRQLCEQAPSTSVLLLSPQPMGKVLCACQVAQGAMPTFTAEAWALAVCSHMGGKAWGSRVVAQGTGSTTDLEAALSIAQTYALSQL
- Température de stockage:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Température de transport:Shipped on blue ice at 4 °C
- Immunogène:Recombinant fusion protein containing a sequence corresponding to amino acids 841 - 985 of human AARS2 (NP_065796.1)
- Purification:Affinity purification
- Type de conditionnement:Plastic vial
- Cdt:100 µl
Spécifications
À propos de cet article
Rabbit polyclonal antibody to AARS2 for WB with samples derived from human.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: AARS2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human